Protein Info for CA264_12105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: methyltransferase, TIGR04290 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04290: methyltransferase, Rta_06860 family
  • amino acids 3 to 224 (222 residues), 345.9 bits, E=4.4e-108
• PF08003: Methyltransf_9
  • amino acids 33 to 158 (126 residues), 62.9 bits, E=1.1e-20
• PF13489: Methyltransf_23
  • amino acids 46 to 214 (169 residues), 38.9 bits, E=2.9e-13
• PF13847: Methyltransf_31
  • amino acids 48 to 149 (102 residues), 44.8 bits, E=4.4e-15
• PF09445: Methyltransf_15
  • amino acids 52 to 167 (116 residues), 24.9 bits, E=5.5e-09
• PF13649: Methyltransf_25
  • amino acids 52 to 130 (79 residues), 50.9 bits, E=8.4e-17
• PF08241: Methyltransf_11
  • amino acids 53 to 132 (80 residues), 44.5 bits, E=8.1e-15
• PF08242: Methyltransf_12
  • amino acids 53 to 136 (84 residues), 38.4 bits, E=7e-13

Best Hits

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 63% identity to vpe:Varpa_3062)

Predicted SEED Role

"Methyltransferase type 11"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See A0A1X9YTC7 at UniProt or InterPro

Protein Sequence (271 amino acids)

>CA264_12105 methyltransferase, TIGR04290 family (Pontibacter actiniarum KMM 6156, DSM 19842)
MTEIDQLGPWFHNLHLPNGEQTAPNHFLGDFPKFKWQEMEPYIPADLSGWNVLDVGCNAG
FYSIELARRGAQVLGIDVDPHYLRQAKWAAKQFGLEDKIELKQMQVYDVAHLEREFDLIW
YMGVLYHLRYPLLSLDILSQKCRRQMVFQTLTMPGNEAADTPDDFDINDRQRMLGESWPK
MAFIEKRMAGDLTNWWAPNHAAIEAMMRSCGLRVKERPGHELYVLEVDEELKQHQQWNRS
EYLSATGQDWQEAVQHKVEGKNTYMLDRHKK