Protein Info for CA264_12055 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02482: 6-phosphofructokinase
  • amino acids 3 to 303 (301 residues), 406.9 bits, E=2.2e-126
• PF00365: PFK
  • amino acids 3 to 278 (276 residues), 368 bits, E=1.6e-114

Best Hits

Swiss-Prot: 63% identical to PFKA_CYTH3: ATP-dependent 6-phosphofructokinase (pfkA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 70% identity to mtt:Ftrac_0899)

MetaCyc: 47% identical to phosphofructokinase (Thermotoga maritima)
6-phosphofructokinase. [EC: 2.7.1.11]

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sedoheptulose bisphosphate bypass (2/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• 1,3-propanediol biosynthesis (engineered) (6/9 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• galactitol degradation (2/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (1/4 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• N-acetyl-D-galactosamine degradation (1/5 steps found)
• lactose degradation I (1/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.11

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

See A0A1X9YTB7 at UniProt or InterPro

Protein Sequence (323 amino acids)

>CA264_12055 6-phosphofructokinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRIGVFTSGGDSPGMNACIRAVVRTAVYHGLEVYGIHRGYKGMIQGEIYRMDSHSVSNI
IQKGGTILRSARSKEFMTPEGRKKAYDQLQQHGIEGLVAIGGDGTFTGANIFFEEYGIPT
VGAPGTIDNDLFGTDYTIGYDTAVNTALDAIDKIRDTADSHDRVFFIEVMGRDSGYIAIP
CAIGGGAEIVMIPETETSIDYVVDTLRTGWNRSKTSFIVIVAEGDDAGNATQVAAQVQHE
LPHMDARVTILGHVQRGGSPTAADRMLASQLGIACVEGLIGGHKCEMAGIINGELTYTPF
IETITKDKLINPQYVKMVDILSV