Protein Info for CA264_11810 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF12917: YfbR-like" amino acids 14 to 144 (131 residues), 34.8 bits, see alignment E=2.1e-12 PF13023: HD_3" amino acids 15 to 170 (156 residues), 151.9 bits, see alignment E=2.4e-48 PF01966: HD" amino acids 35 to 141 (107 residues), 26.4 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K07023, putative hydrolases of HD superfamily (inferred from 60% identity to dfe:Dfer_2176)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YT77 at UniProt or InterPro

Protein Sequence (212 amino acids)

>CA264_11810 HAD family hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEELKRVLEVLHLAEKLKYELRHSWLSNGRQESVAEHTWRMSLMLVLLEPYLDNEIDVA
RALKMVIVHDLVEAEAGDIPAFEVFTAEMKELKRVRELKAIDNLREALGNGIGQHVYELW
HEFEDKLTYEARVANALDKLEVQIQHNHASMDAWLEIEQEFVFLMGQHTEFDACLSQLKE
LIEELAVQKMEAAGIDVAAVKQRMLTKPAVGA