Protein Info for CA264_11425 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 3 to 296 (294 residues), 47.5 bits, E=2.2e-16
• PF02826: 2-Hacid_dh_C
  • amino acids 114 to 291 (178 residues), 175.5 bits, E=1e-55

Best Hits

Swiss-Prot: 55% identical to YOAD_BACSU: Putative 2-hydroxyacid dehydrogenase YoaD (yoaD) from Bacillus subtilis (strain 168)

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 69% identity to dfe:Dfer_3130)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

See A0A1X9YT08 at UniProt or InterPro

Protein Sequence (333 amino acids)

>CA264_11425 hydroxyacid dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRILITAPYHEKALEQLQATFGEIIYRPWKPHGRAYNEQELKALLADTQAEALITEHDHV
TEEVISAYPDLQFIGVCRGTPSNVAVSTATELDIPIFNTPARNAQAVAEMFVANTISLLR
HTMAGCAWLQGENWEAGAHTSYLQFKGNELAGRTIGMVGFGAIGQRIAEMVRCFPCDIQF
YDPFMESPDPAYKKMTLEEVFTTSDIVSVHLPVTEQTINMIDASLISLMKPDAIFVNTAR
AAVVKREDLLDALENKRIRGAILDVFDHEPPDETDYKIIHMPHVLATPHIAGATFEVEDH
HADIMNAALQKWFVEGKKELKQLVNKDILTLQS