Protein Info for CA264_11345 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aquaporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 166 to 192 (27 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details PF00230: MIP" amino acids 3 to 238 (236 residues), 146.2 bits, see alignment E=6.8e-47 TIGR00861: MIP family channel proteins" amino acids 6 to 238 (233 residues), 177.4 bits, see alignment E=1.8e-56

Best Hits

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 71% identity to cly:Celly_0792)

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSZ2 at UniProt or InterPro

Protein Sequence (243 amino acids)

>CA264_11345 aquaporin (Pontibacter actiniarum KMM 6156, DSM 19842)
MTAFTAELIGTMLLILLGNGVVANVVLKGTKGNNSGWIVITTGWALSVFTGVVIAGPYSG
AHLNPAVTLALALAGKFGWHLVGGYVLAQLLGAMLGAFLVWLLYRPHFDATEDAFSQLAV
FCTGPAIRHRFSNIFSEALGTFVLIFVIFYFTNPELGEQKTPIGMGSLGAIPVAFLVWAI
GLSLGGTTGYAINPARDLGPRVIHALMPIKNKCHSDWGYAWVPVAGPLMGAGVAALLYLA
LNV