Protein Info for CA264_11305 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF08220: HTH_DeoR" amino acids 7 to 61 (55 residues), 69.9 bits, see alignment E=3e-23 PF08279: HTH_11" amino acids 7 to 49 (43 residues), 35.7 bits, see alignment 1.6e-12 PF00455: DeoRC" amino acids 76 to 234 (159 residues), 167.8 bits, see alignment E=4.9e-53

Best Hits

Swiss-Prot: 38% identical to AGAR_ECOL6: Putative aga operon transcriptional repressor (agaR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02081, DeoR family transcriptional regulator, aga operon transcriptional repressor (inferred from 73% identity to psn:Pedsa_2890)

Predicted SEED Role

"Transcriptional repressor of aga operon" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSU8 at UniProt or InterPro

Protein Sequence (254 amino acids)

>CA264_11305 transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MVSIAERHQQIIDKLQKEGKINVADLCAELNVSSVTIRKDLKLLEDKGLLFRTHGGATLN
NPYTIDRSVNEKEKIQSSEKMQIGAKAATLLQPNDSILIASGTTVLALAKNIQPSGSLTV
ITSALNVALELLRHPEIEVLQLGGLLRKSSSSVTGPYAESILADFSFSKLFLGVDGIDLE
FGLTTTNVMEAHLNRQMIKVSQKTVVLADSTKFGKRGFGRICGFDDIDQIITDKGISDYV
VKALEGMGIKVTIV