Protein Info for CA264_11300 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 207 to 232 (26 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details PF21088: MS_channel_1st" amino acids 332 to 370 (39 residues), 27 bits, see alignment 5.3e-10 PF00924: MS_channel_2nd" amino acids 372 to 437 (66 residues), 72.6 bits, see alignment E=3.5e-24 PF21082: MS_channel_3rd" amino acids 447 to 528 (82 residues), 39.6 bits, see alignment E=8.5e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSW3 at UniProt or InterPro

Protein Sequence (597 amino acids)

>CA264_11300 mechanosensitive ion channel protein MscS (Pontibacter actiniarum KMM 6156, DSM 19842)
MPYIRKPFRGFLYFCSVLLLLFLAAGAPATAQEEAADTTEAAQADVEPSWPMDSLGRRTP
RSAVEGFISAVANENYDKAAEYLRLAPSLQENLDGAELARALQRLLDQNGKIYPYALISN
DTNGVQDDGLGPNLDRVGEATVNGETFSLILEKTEGPDGGPVWKFSSQTVQRIPFQDEEE
AFVPLVSQLSPSVLEDNKWGGVPVGHWLAILLLVVVAYLLAWGIVSLALYLIRLSWYKVR
EEPTAGIVKAFALPLRIYFTVWIFVVASQQVGISIIVRQRFSEITLIVGVAAVLLLVWRL
LDAITQFVQRRLLHRNNMAGVSALLFLRRAAKVALVVLGVITLLDSIGFDVTTGLAALGI
GGIALALGAQKTVENFVGSVTLIADQPVRVGDFCKAGDVVGTVEQIGMRSTRIRTLERTI
VTIPNGELSSLKIENYAHRDRFWFHPTFGLRFETTPDQIRYLLVELRSILYAHPKVDPSP
ARIRFVKIGADSLNLEVFAYVNAIDFDEFLEVQEDLYLRMMDVVEASGTGFAFPSQTLYI
ARDQGLSKEKSEEAEEQVQKWRAANDVQIPKFTPERIQSLRNTISYPSNGSSLQKKG