Protein Info for CA264_11255 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase M13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05649: Peptidase_M13_N" amino acids 50 to 430 (381 residues), 430.1 bits, see alignment E=1.1e-132 PF01431: Peptidase_M13" amino acids 482 to 683 (202 residues), 248.7 bits, see alignment E=4.2e-78

Best Hits

KEGG orthology group: K07386, putative endopeptidase [EC: 3.4.24.-] (inferred from 72% identity to phe:Phep_1239)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSX9 at UniProt or InterPro

Protein Sequence (686 amino acids)

>CA264_11255 peptidase M13 (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNVSNWKNHLRLLLFGAATLYGVDAAAQQNGAPKGPFIDKSNMDLSVKPGDDFYTYASG
AWIKSNPVPAKETRWGSFNLLRDFNINAVKDILNETAADKNAAPGSVKKRVGDFYAAAMD
SATIDKLGYKPIKKDLKRAGSVKDVNGILNEVAYQKTAGIASPMFGFYVGQDRKDVNTMI
PQLSQGGTTLPDRDYYLKDDARSQKIQQAYKAYITKLFTLTGTPEAKAQQNAETIFNLEK
KMAEAQMARVEMRDPYKTYNKFAVADFSKTTPNMDWKSLMAKLKVTGEDTILVNNPKFFT
ELNGLLTSTPTADWQTYLQWNVLKSSAPYLSTPFVDANFAYTQALTGQKVQTPRWQRMSS
LTDNTVGELLGQLYVEKHFKPEAKARMNELISNLIKAYEIRINNLDWMSAATKEKALAKL
HAFRPKVGYPDKWKDYEGLEINRKAFFQNVRNAGEWGYKDMVSQLGKPVDRTKWGMTPPT
VNAYYSPVMNEIVFPAGILQFPFFDPNADDAVNYGGIGAVIGHEISHGFDDSGSQYDKDG
TLRNWWTAEDRSRFEEKAAALAAQYDAYTVLDTIHVNGKLTLGENIGDLGGLSAAYEAFK
MTEQGQSKEMIDGFTPDQRFFLSWAQVWRGNILPEAAAQQIVTDPHSPGQYRTIGAPVNM
DAWYEAFNVQPGDKLYKAPEDRIRLW