Protein Info for CA264_11210 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00005: ABC_tran" amino acids 19 to 158 (140 residues), 99.8 bits, see alignment E=3.3e-32 PF08402: TOBE_2" amino acids 258 to 325 (68 residues), 30.9 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 53% identity to cpi:Cpin_2162)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSU7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>CA264_11210 ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSFLNVAEISLQQQEGFALQNINFTQLEFQKVAIAGETGSGKSTLLKIVAGLLQPASGQV
YFEGERVLGPEEKLVAGHPGISYLSQHYELPHSLRVEQVLRYANALSAEDAETLYEVCRV
SHLLQRRTNQLSGGEKQRIALARLLSSSPQLLLLDEPFSNLDMVHKKVLKSVIHDISEEL
GVTCLLTSHDPLDTLSWADEILVMRAGQMLQKGTPTQIYRQPESEYIAGLFGDYNLIPAA
KAKVLATLPGIRANGKELLVRPESFKLVPQQEGTVTGKVKDTRYYGSYHAVDVQLGEATV
TVKTGSGLAKGDQVHVALAPEDVWYL