Protein Info for CA264_11170 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4-alpha-glucanotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 440 to 452 (13 residues), see Phobius details TIGR00217: 4-alpha-glucanotransferase" amino acids 6 to 502 (497 residues), 392.3 bits, see alignment E=2.3e-121 PF02446: Glyco_hydro_77" amino acids 12 to 484 (473 residues), 563 bits, see alignment E=2.8e-173

Best Hits

Swiss-Prot: 45% identical to MALQ_CLOBU: 4-alpha-glucanotransferase (malQ) from Clostridium butyricum

KEGG orthology group: K00705, 4-alpha-glucanotransferase [EC: 2.4.1.25] (inferred from 49% identity to mem:Memar_1054)

Predicted SEED Role

"4-alpha-glucanotransferase (amylomaltase) (EC 2.4.1.25)" in subsystem Glycogen metabolism or Maltose and Maltodextrin Utilization (EC 2.4.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSX4 at UniProt or InterPro

Protein Sequence (504 amino acids)

>CA264_11170 4-alpha-glucanotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIIPERSAGILLHITSLPSRFGIGDLGPEAYTFADQLQEAGQRYWQILPLNPTEIGYGNS
PYSSHSAFAGNPLLISPEQLVQEGLLQQKDLRHSESFHDAKVDFEQVSAFKVKLLHKAYK
NFSNELPDALWKDFASFQKEHKLWLQDYARFAAFKKHYKHKSWVQWPEEVKWRKKKAIEE
LAEQLQEQVEFEMFLQFLFYHQWQKLKVYCNQKGIVFFGDMPFYVSHDSADVWSHPDLFK
LDEEGNPTAVSGVPPDYFSETGQLWGTPVFDWKKLQEQDFDWWLHRIAHNLKLFGLLRLD
HFRAFSAYWEVPAGEETAVNGEWVKTPGAPLLKLVQERFKELPIVAEDLGEIDQPVRDLM
HKFDLPGMRVLLFAFGEDLPHSIYAPHQHTQNSIVYTGTHDNNTVRGWYEHEASRDDKRR
LRQYSNHYVNIDNVHGVLIWLSYISVAQLAVIPMQDVLGLGIGHIMNKPSTGSGNWEWRM
QPHQFTPEHRAELKELSQRYGRWK