Protein Info for CA264_11135 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DUF2179 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details PF18955: DUF5698" amino acids 33 to 89 (57 residues), 77.7 bits, see alignment E=7.6e-26 PF10035: DUF2179" amino acids 125 to 174 (50 residues), 38.8 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 49% identical to Y1511_METMJ: UPF0316 protein Memar_1511 (Memar_1511) from Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

KEGG orthology group: None (inferred from 49% identity to ssm:Spirs_1193)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YST5 at UniProt or InterPro

Protein Sequence (199 amino acids)

>CA264_11135 DUF2179 domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNYFEGIDPVLVNWVLIPALIFLARICDVTLGTLRIVFVSKGNKTVAPILGFLEVLIWLI
AMTQVMENLSNVASYLAWAGGFAMGNFLGLRVEQKLALGQMVVRIITVEPADKLIHRLSG
HGYRLTCIDARGTRGKVNLLFLIVKRKKLQHVLDIVRDYNPQAFYSVEDVRSVSELEVPE
SEPTRHTLFRRAFPLRKSK