Protein Info for CA264_11060 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: iron-sulfur cluster scaffold-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01592: NifU_N
  • amino acids 2 to 125 (124 residues), 177.5 bits, E=6e-57
• TIGR01999: FeS cluster assembly scaffold IscU
  • amino acids 3 to 125 (123 residues), 218 bits, E=1.5e-69

Best Hits

Swiss-Prot: 74% identical to ISCU_HAEIN: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 91% identity to psn:Pedsa_1358)

MetaCyc: 71% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• [2Fe-2S] iron-sulfur cluster biosynthesis (3/10 steps found)

Sequence Analysis Tools

See A0A1X9YSW7 at UniProt or InterPro

Protein Sequence (137 amino acids)

>CA264_11060 iron-sulfur cluster scaffold-like protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MAYSDKVIDHYTNPRNVGTLDKAKNNVGTGLVGAPECGDVMRLQIEVDENQVITDAKFKT
FGCGSAIASSSLATEWLKGKTVDEALAIDNMAIVEELALPPVKIHCSVLAEDAIKTAIND
YRVKNGLPELEMPKSHH