Protein Info for CA264_11050 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: methylmalonyl-CoA epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 4 to 128 (125 residues), 55.6 bits, E=1.1e-18
• TIGR03081: methylmalonyl-CoA epimerase
  • amino acids 4 to 130 (127 residues), 141 bits, E=1.5e-45
• PF13468: Glyoxalase_3
  • amino acids 5 to 101 (97 residues), 32.5 bits, E=1.4e-11
• PF13669: Glyoxalase_4
  • amino acids 6 to 115 (110 residues), 91.8 bits, E=5.3e-30

Best Hits

Swiss-Prot: 46% identical to MCE_PYRHO: Methylmalonyl-CoA epimerase (PH0272) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 70% identity to sli:Slin_5823)

MetaCyc: 40% identical to methylmalonyl-CoA epimerase monomer (Metallosphaera sedula)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1)" in subsystem Propionyl-CoA to Succinyl-CoA Module (EC 5.1.99.1)

MetaCyc Pathways

• propanoyl CoA degradation I (3/3 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• methylaspartate cycle (11/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

See A0A1X9YSR7 at UniProt or InterPro

Protein Sequence (133 amino acids)

>CA264_11050 methylmalonyl-CoA epimerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNVEHIGIAVKNFSEANALYHKLLGVEPYKTEHVASEGVNTSFFKVGGTKIELLEGVNP
ESAISKFIEKRGEGIHHIAFEVEDILAEMERLKGEGFTLLNEQPKKGADNKLVCFVHPKS
ANGVLIELTQEIR