Protein Info for CA264_10985 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 87 to 116 (30 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 13 to 54 (42 residues), 35.7 bits, see alignment 1.3e-12 PF21088: MS_channel_1st" amino acids 63 to 103 (41 residues), 31.5 bits, see alignment 2.8e-11 PF00924: MS_channel_2nd" amino acids 105 to 170 (66 residues), 64.5 bits, see alignment E=1.5e-21 PF21082: MS_channel_3rd" amino acids 178 to 259 (82 residues), 45.7 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 39% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 46% identity to pdi:BDI_2057)

MetaCyc: 35% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXX4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>CA264_10985 mechanosensitive ion channel protein MscS (Pontibacter actiniarum KMM 6156, DSM 19842)
MLDIDSIREMVVNFAVLYGMKLLVALVILVVGTWIIRRLNKLIQNLMVRKGVDESLRPFL
GSILNVTLWVLLIVLVIAQLGVEMTSFIAVLGSAGLAIGLALQGSLSNFAGGVLILTIKP
FRVGDYIEAQGQGGTVHLINIFNTVLKTADNKTIYLPNGPLASTVVVNYSVEATRRVELL
FTVSVHNDIGKVRSLIQELIAQDERVLQEPAPVIVVTNFAEHAITISTRIWCNRADYWAL
YWDMNEKAKAAFEQNNIAMPVPKREVFSFESGPSQPAVGA