Protein Info for CA264_10925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: fatty acid hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K02294, beta-carotene hydroxylase [EC: 1.14.13.-] (inferred from 54% identity to dfe:Dfer_2033)

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSS3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>CA264_10925 fatty acid hydroxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLTGVGIMLFTFVAMEGVAWVMHKYVLHGFLWFLHKSHHTRHTHAFELNDLFFAYYGTLA
MLFFVFGSDPIDYRFWVGAGITLYGVAYFVIHDVFIHRRIRVFGKTSNVYLKALNMAHKV
HHKEQGKHGSESFGMLWVSPRYFRSAYDIVKKKEQEKRGSVHY