Protein Info for CA264_10910 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phytoene dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01494: FAD_binding_3" amino acids 4 to 44 (41 residues), 23.9 bits, see alignment 1.2e-08 PF00070: Pyr_redox" amino acids 5 to 39 (35 residues), 23.2 bits, see alignment 4e-08 PF03486: HI0933_like" amino acids 5 to 39 (35 residues), 22.7 bits, see alignment 1.9e-08 PF01266: DAO" amino acids 5 to 54 (50 residues), 37.7 bits, see alignment 8.9e-13 TIGR02734: phytoene desaturase" amino acids 6 to 492 (487 residues), 445.3 bits, see alignment E=1.4e-137 PF00890: FAD_binding_2" amino acids 6 to 47 (42 residues), 30.9 bits, see alignment 8.8e-11 PF13450: NAD_binding_8" amino acids 8 to 68 (61 residues), 63.4 bits, see alignment E=9.8e-21 PF01593: Amino_oxidase" amino acids 13 to 486 (474 residues), 114.5 bits, see alignment E=4.1e-36

Best Hits

KEGG orthology group: K10027, phytoene dehydrogenase [EC: 1.14.99.-] (inferred from 66% identity to mtt:Ftrac_1472)

Predicted SEED Role

"Phytoene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.99.-

Use Curated BLAST to search for 1.14.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSV5 at UniProt or InterPro

Protein Sequence (498 amino acids)

>CA264_10910 phytoene dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNGTRVIVIGSGFSGLSAATSLADQGYDVTVLEKNSSPGGRARSFSANGFTYDMGPSWYW
MPDVFESYFNKFGKTTSDYYDLKRLDPSYTVVFGEDDFVEIPAQLSQLRELFERLEKGSA
ARLDKFLEQAAYKYEVGIKQLVYKPGRSLTEFMNPRLLLDVLRMDVFQSFHKHIRRFFGH
EKLIKLMEFPILFLGALPQNTPALYSLMNYADISLGTWYPMGGMFRIVEGMVQLAEEKGV
KFLYNQDVQRLDVVQGAVKQVLTETDAFAADVVVASADYHHVEKALLPKASQSYSDSYWE
SRVMAPSSLLYYVGVNKRLKNLQHHNLFFDEDFGPHAEEIYTHPQWPAKPLFYVSAPSVT
DPSVAPEGCENLFILIPVAPGLQDTEELREQYFNLVMDRLERLTKQEIRSSIVYRRSYAH
RDFIQDYNAFKGNAYGLANTLLQTAILKPGLKSKKVRNLYYTGQLTVPGPGVPPSIISGQ
VVASEIAKEYAPALAVNV