Protein Info for CA264_10895 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF18916: Lycopene_cyc
  • amino acids 2 to 94 (93 residues), 61.4 bits, E=5.1e-21
  • amino acids 129 to 217 (89 residues), 74.2 bits, E=5.1e-25
• TIGR03462: lycopene cyclase domain
  • amino acids 2 to 91 (90 residues), 63.5 bits, E=1e-21
  • amino acids 129 to 214 (86 residues), 50.2 bits, E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 44% identity to fte:Fluta_0904)

MetaCyc: 51% identical to lycopene beta-cyclase (Algoriphagus sp. KK10202C)
RXN-19178 [EC: 5.5.1.19]

Predicted SEED Role

No annotation

MetaCyc Pathways

• flexixanthin biosynthesis (2/5 steps found)
• β-carotene biosynthesis (engineered) (2/8 steps found)
• superpathway of carotenoid biosynthesis in plants (3/22 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.19

Sequence Analysis Tools

See A0A1X9YST3 at UniProt or InterPro

Protein Sequence (232 amino acids)

>CA264_10895 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MYLYLYLNIFTILFPLLLSFDKKVAFYKNWGSLFPAILANGLLFVAWDALFTEAGIWGFN
EAYLTGIYLFNLPLEEVLFFLTVPYACVFIYDVLNAYISKDLLRPVAKPLALALILALPL
VAVFNAAALYTSITFCLLAVMHLLHLRFFGTKYLGRFYLAYLVHLVPFLLVNGVLTYLPI
VWYNDSFNLGLRIVSIPVEDTMYSMLMLLLTISVYEALRQRKRVKQYEPIAV