Protein Info for CA264_10840 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 2 to 89 (88 residues), 34.6 bits, E=3.9e-12
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 3 to 441 (439 residues), 404.3 bits, E=3.8e-125
• PF21377: MurD_N
  • amino acids 3 to 73 (71 residues), 37.8 bits, E=3.2e-13
• PF08245: Mur_ligase_M
  • amino acids 106 to 285 (180 residues), 107 bits, E=2.7e-34
• PF02875: Mur_ligase_C
  • amino acids 306 to 376 (71 residues), 33 bits, E=1.2e-11

Best Hits

Swiss-Prot: 50% identical to MURD_GRAFK: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Gramella forsetii (strain KT0803)

KEGG orthology group: None (inferred from 52% identity to lan:Lacal_0551)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See A0A1X9YSQ6 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CA264_10840 UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLAILGAGESGVGAALLAKAKGLEVFVSDKGEIKEQYKAKLATAAIPFEEGTHTLVNIL
DADEIIKSPGIPDKAAVIQEATKKEIPVISEIEFAGRYTNAKFICITGTNGKTTTTLLTY
HLLKSAGLNVALAGNIGESLAEKVIDNKYDYYVVELSSFQLDNMYQFQAHIAVLLNITPD
HLDRYNYSMEKYAASKLRVAQNMTGANFFLFNADDENIAKAFDSASFGGTTVPFSLKGAE
GARVYMEGKEVKVTEKFYEGTVDTSASGLIGRHNQYNTMAAVGVAKLLGVADDTIGQALE
TFENAEHRLQQIAVAKEVTYINDSKATNVEAVWYALDGIKQPIVWIAGGVDKGNDYSTLQ
ELAREKVKVLVCLGKDNEKLKEAFGRIVPIIAETTSIEYAVRLSRSLATPGDVVLLSPAC
ASFDLFNNYEHRGQRFKEAVEKIVLKKK