Protein Info for CA264_10750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF01209: Ubie_methyltran" amino acids 21 to 144 (124 residues), 43.6 bits, see alignment E=7.2e-15 PF13489: Methyltransf_23" amino acids 27 to 162 (136 residues), 40.5 bits, see alignment E=7.3e-14 PF13847: Methyltransf_31" amino acids 46 to 144 (99 residues), 56.4 bits, see alignment E=9.5e-19 PF13649: Methyltransf_25" amino acids 47 to 138 (92 residues), 66.1 bits, see alignment E=1.1e-21 PF08242: Methyltransf_12" amino acids 48 to 139 (92 residues), 49.3 bits, see alignment E=2.1e-16 PF08241: Methyltransf_11" amino acids 50 to 141 (92 residues), 74 bits, see alignment E=3.8e-24

Best Hits

KEGG orthology group: K00551, phosphatidylethanolamine N-methyltransferase [EC: 2.1.1.17] (inferred from 54% identity to cvi:CV_4378)

Predicted SEED Role

"putative phosphatidylethanolamine N-methyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSM2 at UniProt or InterPro

Protein Sequence (206 amino acids)

>CA264_10750 SAM-dependent methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLNTNSWNRLRYTLYLPIYDFIADRVFRKYRQRSVQLLAAKPDDAILILGAGTGLDLPY
LQGHTKLTAIDITPGMISKLKQRAEELRVPVQAQVMNGQALAFADASFDAVVLHLILAVI
PDPVACIKEVERVLKPGGTVMVFDKFLADGQEPSVLRRLLNHLAGTLFSDINRRIGNIIS
HTRLQQELNEPAALGGAFRLVRLRKQ