Protein Info for CA264_10695 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: anti-sigma regulatory factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF13581: HATPase_c_2" amino acids 13 to 128 (116 residues), 38.2 bits, see alignment E=1.4e-13 PF02518: HATPase_c" amino acids 35 to 128 (94 residues), 50.5 bits, see alignment E=2.7e-17

Best Hits

Swiss-Prot: 39% identical to RSBT_BACSU: Serine/threonine-protein kinase RsbT (rsbT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 70% identity to fjo:Fjoh_3135)

Predicted SEED Role

"anti-sigma B factor RsbT" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY31 at UniProt or InterPro

Protein Sequence (134 amino acids)

>CA264_10695 anti-sigma regulatory factor (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKDAMQIVREQDVVPFRNRVKELATKIGMSLVNQTKLITAASELVRNMLKYANGGKVLL
EIISKNAQTGVRLTFVDEGPGIADVQQAMRDGFSTGKSLGLGLPGTKRLVNEFDIKSKLG
EGTTVTITHWKNGR