Protein Info for CA264_10565 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 20 to 291 (272 residues), 191.6 bits, see alignment E=9e-61 PF01545: Cation_efflux" amino acids 21 to 209 (189 residues), 134.8 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 46% identity to cts:Ctha_1590)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSL5 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CA264_10565 cation transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MGHHHHHHHGHHHHHATGNIKFAFFLNLGFAVLELVGGFFVNSVAIMSDALHDFGDSLAL
GMAYFLQRKSEQEGNARYTYGYKRYSVAGALLTSLILIVGAGFIVAEAVERLLDPAMPEP
LGMLAFAILGIAVNGAAFFKLQGGFNLNQKAVSLHMLEDLLGWVAVLIVSVVLLFFELPW
LDPLLSVGISLFMLVHALRNAFAALKVLLQANPLADRLEQVRAQLLALQPVLGVHQLRVW
SLDGEHHVLSAHVVVAAVGEPDAAATLKNEIRNALKPFSITEVTLELEQAEERCALQVQV
YL