Protein Info for CA264_10545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GTP 3',8-cyclase MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 2 to 329 (328 residues), 342.9 bits, see alignment E=8.8e-107 PF04055: Radical_SAM" amino acids 17 to 175 (159 residues), 95.6 bits, see alignment E=5.9e-31 PF06463: Mob_synth_C" amino acids 182 to 305 (124 residues), 99.3 bits, see alignment E=2.5e-32

Best Hits

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 65% identity to hhy:Halhy_1976)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSJ5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CA264_10545 GTP 3',8-cyclase MoaA (Pontibacter actiniarum KMM 6156, DSM 19842)
MLIDNHGRRVNYLRLAVTDRCNLRCFYCMPEHGNEWLQRKELMTYEEMLQICSVLVKMGV
DKVRITGGEPFVRKGMMRFLSDLTKLPGLEQVSITTNGVLTAPLVPELKKIGIHSVNLSL
DTLDRNRFFAITRRDVLPDVMHTLEALLQHELPVKLNTVVMDGKNVQDIKPLVELTKELP
VSVRFIEEMPFNGSGDHNTHLPWDHFRILEAIREDFPGIQKVPDPANSTAYHYRIPGHKG
NVGIIAAYTRSFCGSCNRLRLTPQGVLKTCLYGDGVLNVRDLMRAGTGEAVLQQTLTKAI
GSREKDGWEAEKNAAAISSLSASMATIGG