Protein Info for CA264_10535 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 4 to 153 (150 residues), 192.9 bits, see alignment E=1.2e-61 PF01967: MoaC" amino acids 15 to 151 (137 residues), 170.8 bits, see alignment E=7.7e-55

Best Hits

Swiss-Prot: 57% identical to MOAC_XANC8: Cyclic pyranopterin monophosphate synthase (moaC) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 68% identity to hhy:Halhy_1974)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSK6 at UniProt or InterPro

Protein Sequence (158 amino acids)

>CA264_10535 cyclic pyranopterin monophosphate synthase MoaC (Pontibacter actiniarum KMM 6156, DSM 19842)
MSDFSHLDEKGQATMVDVSAKQVTQRTATARSVVALPAEVLEKFAENDIQTKKGAVFQTA
VLAGIMAAKKTGDLIPLCHPLGLDNCHITIRVNEQQEVEIDCTASVTARTGVEMEALVGA
SVAALTVYDMCKALSHDIVIKETKLLEKTGGKRDFKRA