Protein Info for CA264_10525 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: molybdenum cofactor biosynthesis protein MoaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF02391: MoaE" amino acids 6 to 117 (112 residues), 137.9 bits, see alignment E=8.2e-45

Best Hits

Swiss-Prot: 45% identical to MOAE_BACHD: Molybdopterin synthase catalytic subunit (moaE) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 59% identity to hhy:Halhy_4056)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSK5 at UniProt or InterPro

Protein Sequence (138 amino acids)

>CA264_10525 molybdenum cofactor biosynthesis protein MoaE (Pontibacter actiniarum KMM 6156, DSM 19842)
MIDIRLTEAPLRIAACIEWVMTPESGGIDVFVGTVRNATQGRQVQRLEFEAYAQMARNEM
TKIAEQALEKWPLHKVLLHHRTGVLQVGEVPVVIAVSAAHRAAAFDACRYIIDTLKQTVP
IWKKEVFEDGEAWVAAHP