Protein Info for CA264_10520 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: molybdopterin synthase sulfur carrier subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to MOC2A_MAIZE: Molybdopterin synthase sulfur carrier subunit (VP15) from Zea mays
KEGG orthology group: K03636, molybdopterin synthase sulfur carrier subunit (inferred from 49% identity to hhy:Halhy_2124)MetaCyc: 36% identical to molybdopterin synthase sulfur carrier subunit (Homo sapiens)
RXN-8342 [EC: 2.8.1.12]
Predicted SEED Role
No annotation
MetaCyc Pathways
- molybdopterin biosynthesis (2/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YSM8 at UniProt or InterPro
Protein Sequence (80 amino acids)
>CA264_10520 molybdopterin synthase sulfur carrier subunit (Pontibacter actiniarum KMM 6156, DSM 19842) MKVHVLAFGIARDIFGGSSADVEVKEGATVQELRAALEAKYPRLKQLTSFMMAVNNEYAT GECVLQQRDEVAVIPPVSGG