Protein Info for CA264_10515 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: anion permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 6 to 35 (30 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details PF01925: TauE" amino acids 6 to 245 (240 residues), 125 bits, see alignment E=2.1e-40

Best Hits

Predicted SEED Role

"Possible sulfoacetate exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSF6 at UniProt or InterPro

Protein Sequence (252 amino acids)

>CA264_10515 anion permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MQHWEIIALFFFIAFVYASVGFGGGSSYLAILALYSFPFKEIRLIALVCNIVVVTGGTIL
FVRHGQVNWRKIVPLVAVSVPLAYAGASLRIAQHTFFILLGICLLLAAVLLWIGNRAYTE
KDTLAAAKKPAYVKDGALGGSIGFLSGMLGIGGGIFLSPVLNLARWDTPRRIAATASVFI
LVNSVSGIAGQLTHLPASINFERIGLLALAVFAGGQLGSRLAVIKFNHLVIRRMTAALIF
VAGIEVLYKHLG