Protein Info for CA264_10450 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF13302: Acetyltransf_3" amino acids 5 to 149 (145 residues), 27.1 bits, see alignment E=1.6e-09 PF13673: Acetyltransf_10" amino acids 34 to 155 (122 residues), 43 bits, see alignment E=1.1e-14 PF00583: Acetyltransf_1" amino acids 40 to 148 (109 residues), 68.2 bits, see alignment E=1.9e-22 PF13508: Acetyltransf_7" amino acids 59 to 150 (92 residues), 48.6 bits, see alignment E=2.3e-16

Best Hits

Swiss-Prot: 43% identical to PAIA_BACSU: Spermidine/spermine N(1)-acetyltransferase (paiA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 62% identity to gfo:GFO_2080)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YSH0 at UniProt or InterPro

Protein Sequence (175 amino acids)

>CA264_10450 N-acetyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MENISIRKVTLKDIDQLQKIGRQTFYETFSAGNTEENMKKYLEEGFSTEKVTAELNNENS
EFYFASIDDFVIGYLKINFGLSQTELKDDKALEIERIYVLSEYHGKRIGQLLYEKAMQIA
KQSNADYIWLGVWEENPRAISFYKKNGFVEFDKHIFKLGDDEQTDIMMKLQLNDR