Protein Info for CA264_10105 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 113 to 139 (27 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 66% identity to shg:Sph21_2693)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS96 at UniProt or InterPro

Protein Sequence (351 amino acids)

>CA264_10105 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MFRIFSTLNGKALINAAVATVLLIVLVYVGSRDLQNFDAALIAYLFGSIFALFGVVYRYS
VWLQRPPTRLYWRRTWKFVFSKRFFPYLGFVISQFFKNILFQRFIYPRGKTRWWGHFLLA
TGCMLAFMVTFPLTFGWIHFTLAPGTLDTYEAHVFGFKVAAFELGGLVAFNAFHILNWCS
LFVIIGAIMMMRRRLTNGGLIATQSFQDDWLPLVLLLAISVTGLGLTFDYSFMQGKTFEF
MSVTHAITVILFLIWIPFGKFFHIFQRPAQLGTNVYRREGARLGMAICPHTKEAFATQLH
VDDLKKVTKELDFNFDLPDGGSHLDYSPEGKRAALAKAQFAAREQQGQFFG