Protein Info for CA264_10095 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4Fe-4S ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12800: Fer4_4
  • amino acids 20 to 33 (14 residues), 10.6 bits, see alignment (E = 0.00032)
  • amino acids 93 to 108 (16 residues), 19.3 bits, see alignment (E = 4.8e-07)
• PF13247: Fer4_11
  • amino acids 58 to 150 (93 residues), 73.8 bits, E=4.9e-24
• PF13237: Fer4_10
  • amino acids 59 to 106 (48 residues), 28.4 bits, E=5.9e-10
• PF12838: Fer4_7
  • amino acids 62 to 109 (48 residues), 27.6 bits, E=1.4e-09
• PF13187: Fer4_9
  • amino acids 62 to 108 (47 residues), 27 bits, E=1.7e-09
• PF00037: Fer4
  • amino acids 91 to 110 (20 residues), 28.3 bits, see alignment (E = 5.2e-10)
• PF12837: Fer4_6
  • amino acids 91 to 110 (20 residues), 25.9 bits, see alignment (E = 3.3e-09)

Best Hits

KEGG orthology group: None (inferred from 83% identity to shg:Sph21_2695)

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)
• superpathway of C1 compounds oxidation to CO₂ (2/12 steps found)
• purine nucleobases degradation I (anaerobic) (4/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See A0A1X9YSG2 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CA264_10095 4Fe-4S ferredoxin (Pontibacter actiniarum KMM 6156, DSM 19842)
MALEPEKNFNPDMEFFVDMQRCIGCRACEAACAECETNGQETMIHVNYVDRAHSVQTTVQ
VCMHCEDPACANVCPADAIAKDSNGVVHSANTSRCIGCSNCVMACPFGVPKKMEAAELMM
KCNLCYDRTSVGKKPMCATVCPSGALFYGTREEIRKMRPNSDPVNTFQFGAQTVHTKVNV
MMPKGSTALRVH