Protein Info for CA264_09950 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: conjugative transposon protein TraJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details TIGR03782: Bacteroides conjugative transposon TraJ protein" amino acids 31 to 356 (326 residues), 382.5 bits, see alignment E=7.1e-119 PF07863: CtnDOT_TraJ" amino acids 304 to 365 (62 residues), 64.5 bits, see alignment E=5.8e-22

Best Hits

KEGG orthology group: None (inferred from 62% identity to fjo:Fjoh_3541)

Predicted SEED Role

"Conjugative transposon protein TraJ" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS93 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CA264_09950 conjugative transposon protein TraJ (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYWKHSLILLACALLLPGLLQAQGLSGETGSLHQVLEQLYGEMLPLCSGLMQVAQGIAG
LGALWYIGSRVWRHIAQAEPIDFYPLLRPFALGLAIVLFPAVLDLLNGVLSPTVAATSAM
VGDSDKAIAVLLQKREEALRGTAAWQMYVGEAGAGDRDRWYAYTHEEAPAGEGLVEGIGN
DIRFAMEKASYSFRNSVKEWLSEVLRLLYEAAALCINTVRTFQLVVLAILGPLVFGLAVF
DGFRHTLTVWSARYINVYLWLPVANIFGAILGKVQEMMLTLDLSQVEEAGETFFSPTDTA
YLLFLVMGIVGYLTVPSVANYIVHASGGNTLLYKISNLFSATSQGTAQAVYAGAATAAGG
VGSTAVAISHLGSWAGGAVSSPGSGQSPDAPSAFQHDRISGEK