Protein Info for CA264_09940 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: conjugative transposon protein TraM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR03779: Bacteroides conjugative transposon TraM protein" amino acids 12 to 410 (399 residues), 211.7 bits, see alignment E=1.1e-66 PF12508: Transposon_TraM" amino acids 247 to 404 (158 residues), 128.3 bits, see alignment E=1.5e-41

Best Hits

Predicted SEED Role

"Conjugative transposon protein TraM" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS74 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CA264_09940 conjugative transposon protein TraM (Pontibacter actiniarum KMM 6156, DSM 19842)
MKHPTSTMSSSRRRRLLLVLPLLSFPFITLLFWALGGGQTRKLYPQDSAQVGLNPSLPHA
QLEEGMAAGKLGYYQQAAHDSAQWLELQHKDPYAPGLVVGGLPPVQTSGALSSLSGSASE
GYQTQQAQVYQKLRQLEAALEDVPVVAPAARTQALPQQTVADIQLGRLEQLMRSAQHEGG
ADPEMQQVSGMLDKILDIQHPQRVLERSMHSSQTGAGQVFSLSFAGPGAPISLLGQHGQE
APVDSVQGFYGWDTPVTADLAPNMLPAVVQETQALVTGAIVKLRLEADVLLNGTRIPRGS
FVFGTVALEGERLRIKVSSIRRGQRLFPVDLSAYDLDGLEGLYIPGAITREVARQSADRA
VQGFGLPSLDSSPELQAARAGVAAAKSLFSKQAKLVRATVKAGYRVLLRDARQT