Protein Info for CA264_09810 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 transmembrane" amino acids 178 to 201 (24 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 241 to 241 (1 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 417 to 443 (27 residues), see Phobius details PF03412: Peptidase_C39" amino acids 4 to 131 (128 residues), 99.4 bits, see alignment E=3e-32 PF00664: ABC_membrane" amino acids 183 to 450 (268 residues), 117.9 bits, see alignment E=1.4e-37 PF00005: ABC_tran" amino acids 533 to 682 (150 residues), 109.9 bits, see alignment E=3.3e-35

Best Hits

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS98 at UniProt or InterPro

Protein Sequence (758 amino acids)

>CA264_09810 ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MHSKYKFYKQLDYMDCGPTCLRMVSAFYGKEYTLDYLRSISHITKNGVSFLGLSEASEKI
GFRTLVGKLSYNQLKEEVPLPCILHWNQDHFVVLYDIKGKTWYRREEKLVIGDPGHNLVE
VDVETFKKCWVSTQDNKGIALLLETTPEFYQPMSEEVATEQHSSSIGFLMQYIRPYKAYI
FQIFLGMVLASFISMCFPFLTQSLVDFGINKQNLNFVYLVLISQLALFIGSLLVNLIRNW
ILLHVSTRISITIISNFLIKLMKLPINFFESKNIGDITQRISDHHRIESFLTGSALSTLF
SIINLVIFSVVLGIYDVRFLFIFLAGSAISVAWIFLFLKKRRNIDYNRFQRARENQNSIY
EIITGMQEIKLYNSQKSRRWEWEKIQSKLFKINLKSLALEQYQEVGSTFFTQLKNIVISF
MAAVLVIDGQISLGVMLSISYIIGQMNGPLSQLIQFVKTVQDAKISLERLGEIHNKQNEE
KSSRLVAGLHEENFGHSLNQAFFAKGLNSRFKPGITLDNVCFRYGHAKSQMVLKNINLHI
PQGKVTAIVGASGSGKTTLLKLLLKFYPATEGTILVDGSNLDDLSAKLWRSQCGTVMQDG
YIFSDSIARNIALDGNKIDELKLMNAVHVANAHEYISQLPLGFTTRIGNTGSGLSGGQKQ
RIFIARAVYKEPNYMFFDEATSALDSNNERVIMENLDEFYKGRTVLIIAHRLSTVKKADQ
IVVMKDGEVVEVGNHMSLVHQRGYYFELVKNQLELDAA