Protein Info for CA264_09735 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 5-hydroxyisourate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02962: hydroxyisourate hydrolase" amino acids 25 to 134 (110 residues), 134.4 bits, see alignment E=1.1e-43 PF00576: Transthyretin" amino acids 26 to 134 (109 residues), 131.7 bits, see alignment E=8.4e-43

Best Hits

Swiss-Prot: 41% identical to HIUH_MOUSE: 5-hydroxyisourate hydrolase (Urah) from Mus musculus

KEGG orthology group: None (inferred from 56% identity to ran:Riean_0115)

Predicted SEED Role

"Transthyretin-like periplasmic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS53 at UniProt or InterPro

Protein Sequence (135 amino acids)

>CA264_09735 5-hydroxyisourate hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKNLALLLLFVLITTVTHAQTSSYQLSSHILDVATGMPAKGVPVQLEKLDETTQQWIQVD
EKRTDDNGRIKEFLSTKSPNVGIYRLRFLVADYFKGKQTESFYPFIEVVFQIKDKEHYHV
PITLSPYGYATYRGN