Protein Info for CA264_09570 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 102 to 129 (28 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 277 to 301 (25 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 33 to 456 (424 residues), 197.8 bits, see alignment E=4.8e-62 PF00324: AA_permease" amino acids 34 to 460 (427 residues), 137.9 bits, see alignment E=6.6e-44 PF13906: AA_permease_C" amino acids 430 to 480 (51 residues), 71.3 bits, see alignment 8.7e-24

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 61% identity to psn:Pedsa_1933)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS32 at UniProt or InterPro

Protein Sequence (497 amino acids)

>CA264_09570 amino acid permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MAKHIFATKSVDNLIRESEGGEHGLKRTLTATNLTMLGVGAIIGAGIFVLTGTAAANAAG
PAIVISFLIAGLGCLFAGLCYAEFASMIPIAGSAYTYGYATLGEFIAWIIGWDLILEYLF
GAATVAVGWSGNFVSLLKSLGIHVPAAIASAPLAYNGSSFELTGALMNLPAIILILIMTA
LLVVGIQESAKLNNVIVIVKVAIVLLVIGFGFQYVNTANWEPFIPAKEILTDGSSRYGWQ
GVVAGAAIVFFSYIGFDAVSTAAQEAKNPQRDMPISMLVSLGICTLLYVLMSLVLTGLVP
FKMLNVPDPVLVALEAAGPALKWLYFFTGVGAVAGLASVVLVMLMGQPRIFYAMSRDGLL
PAIFGTVHPKYKTPYVPTILTGLVAAVVAGIFPIGLLGELVSIGTLLAFVIVCAGIIILR
RTNPNIPRPFKTPLVPLVPALGILICGYMMVNLGFDTWLRLLVWMGIGVVIYFFYGRKHS
KLRKQDTSPAEARELVS