Protein Info for CA264_09550 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 55 to 85 (31 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details PF09335: SNARE_assoc" amino acids 49 to 176 (128 residues), 71.2 bits, see alignment E=5.6e-24

Best Hits

Swiss-Prot: 54% identical to DEDA_ECOLI: Protein DedA (dedA) from Escherichia coli (strain K12)

KEGG orthology group: K03975, membrane-associated protein (inferred from 54% identity to psl:Psta_3154)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS57 at UniProt or InterPro

Protein Sequence (217 amino acids)

>CA264_09550 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MELFQNLLDFILHIDQHLILLLQEYRNWIYLILFLIVFCETGLVVTPFLPGDSLLFALGA
LAAIPSSGLQVALLLGLLCVAAILGDSFNYLTGIKLGAKVYHKNYWFLRQKHLQKAEQFY
VRHGGRTIIYARFIPIVRTFAPFAAGMAKMHYKRFLYFNVVGALLWVFFFIMIGYLFGNL
PAVKQNFSLLVMGIIGVSMLPPVLAFVKQRLVTPVRQ