Protein Info for CA264_09485 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: potassium-transporting ATPase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02669: KdpC" amino acids 2 to 182 (181 residues), 231.6 bits, see alignment E=3e-73 TIGR00681: K+-transporting ATPase, C subunit" amino acids 15 to 183 (169 residues), 163.1 bits, see alignment E=3.8e-52

Best Hits

Swiss-Prot: 56% identical to KDPC_BACFR: Potassium-transporting ATPase KdpC subunit (kdpC) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 62% identity to sli:Slin_0065)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYE6 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_09485 potassium-transporting ATPase subunit C (Pontibacter actiniarum KMM 6156, DSM 19842)
MKQSLILTVWCIGFFVLLYPLSIWAIARMAAPNGGAGKQVTVNGRVVGYENVGQSFTEDR
YFYSRPSAVAYNGGGSGGSNKGPSNPEYLAEVQERIDTFLEQNPTVKRKEVPAELVTASG
SGLDPHLSPQGALVQIERIARVRHLPVEQVRALVQEQVEAPLLGILGPEKVNVLKLNVAL
DQLNAQR