Protein Info for CA264_09470 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 174 to 198 (25 residues), see Phobius details PF00672: HAMP" amino acids 197 to 245 (49 residues), 32.1 bits, see alignment 2.9e-11 TIGR00229: PAS domain S-box protein" amino acids 258 to 316 (59 residues), 26.5 bits, see alignment 2.9e-10 PF00989: PAS" amino acids 260 to 327 (68 residues), 32.1 bits, see alignment E=2.6e-11 PF00512: HisKA" amino acids 381 to 449 (69 residues), 59 bits, see alignment E=9.8e-20 PF02518: HATPase_c" amino acids 501 to 604 (104 residues), 93.8 bits, see alignment E=2.3e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS15 at UniProt or InterPro

Protein Sequence (610 amino acids)

>CA264_09470 PAS domain-containing sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLKTKVTLGYLTILVVLLALGVYSVTNVNKLDRAARNILKANLYTLQVGKRMISSLDNM
QAAKQQLLFSDVTPEVKADMIRENMAVFAANLRKEQGNITEPGEGQLVEDVAEGFQHYRI
LLLNDSLDANAYYVELLPRYRLLRDQLDQMLSMNMDAMISKSDHAQHIAQQTRVYTLVAL
TAALLLTLGFLLTIPAAIAKPINMLVDSIQAASGKDFSKKIPVRGRNEFSRVAKVYNSML
KKLQEYEFSNLNVLMSEKKRIELIMQNLDEGLLLLDHNLQVTEANPVACKLLGMERANLV
GRQSQELENENDLYRELVKDIMIGRTSDDHLLTVTEGGEEAYYCKSVLDIVSYNELKEQS
ELYGYVVSLRNVSEFKRLDQAKSNFLATVSHELKTPLASIGYSLKLLQNERVGAMNEEQT
GIIRTLKQETSRLQKMVGELIDVSRLESGNIQLNVQKTNITDIIHYAEEVISLQLLQKQL
RVEVQLENQLTDVMADVEKTTWVLINLLSNAVRYSPEGDVITITTEDEERQVLIKVHDNG
PGIDASNHSKIFQKFVQIPGKEQYKGGAGLGLSISKEFIESQGGSIWVESELGAGSTFVV
SLPVYHLAEV