Protein Info for CA264_09445 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 3-isopropylmalate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00169: 3-isopropylmalate dehydrogenase" amino acids 7 to 344 (338 residues), 444.4 bits, see alignment E=1.3e-137 PF00180: Iso_dh" amino acids 8 to 345 (338 residues), 417.8 bits, see alignment E=2e-129

Best Hits

Swiss-Prot: 56% identical to LEU3_BACTN: 3-isopropylmalate dehydrogenase (leuB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00052, 3-isopropylmalate dehydrogenase [EC: 1.1.1.85] (inferred from 65% identity to kdi:Krodi_2178)

MetaCyc: 49% identical to beta-isopropylmalate dehydrogenase subunit (Leptospira interrogans serovar Lai str. 56601)
3-isopropylmalate dehydrogenase. [EC: 1.1.1.85]; 1.1.1.- [EC: 1.1.1.85]

Predicted SEED Role

"3-isopropylmalate dehydrogenase (EC 1.1.1.85)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 1.1.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRZ7 at UniProt or InterPro

Protein Sequence (373 amino acids)

>CA264_09445 3-isopropylmalate dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGVLNKRIAVLAGDGIGPEVCQEAVRVLKAVSEKFGHEFTFDRQPMGACAIEATGDPLPD
QTLEACYLADAILLGAIGDPKYDNNPAAKVRPEQGLLKLRKSLGLYANIRPVTAYEVLLP
YSPLKDARIAGADMLFFRELTGGIYFGEKGRIADSAYDHCTYSRFEIARIAHLAFKAAQN
RRGKLTLVDKANVLETSRLWREVVQEISPSYPDVAVDYLFVDNAAMQLILNPKQFDVILT
ENMFGDILSDEASVIAGSLGLLPSASVGETAALFEPIHGSYPQAKGKNIANPIAMILSAA
MMLEHFGLQQEADLVRRSVQVALDKKIVTQDLTPPTLAYSTEQVGAFIAYCVLGGAVEGL
HKKNMEVGMSTVI