Protein Info for CA264_09420 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: maltose acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF12464: Mac" amino acids 7 to 56 (50 residues), 62.3 bits, see alignment E=6e-21 PF14602: Hexapep_2" amino acids 130 to 165 (36 residues), 39.9 bits, see alignment 4.3e-14 PF00132: Hexapep" amino acids 131 to 165 (35 residues), 43 bits, see alignment 3.6e-15

Best Hits

Swiss-Prot: 54% identical to MAA_BACSU: Probable maltose O-acetyltransferase (maa) from Bacillus subtilis (strain 168)

KEGG orthology group: K00661, maltose O-acetyltransferase [EC: 2.3.1.79] (inferred from 74% identity to sli:Slin_1900)

MetaCyc: 48% identical to maltose O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Maltose O-acetyltransferase. [EC: 2.3.1.79]

Predicted SEED Role

"Maltose O-acetyltransferase (EC 2.3.1.79)" in subsystem Maltose and Maltodextrin Utilization (EC 2.3.1.79)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.79

Use Curated BLAST to search for 2.3.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS01 at UniProt or InterPro

Protein Sequence (185 amino acids)

>CA264_09420 maltose acetyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTEKEKMLSGELYNPLDAQLSEERLRARFLLKELNDASEDQKEERARLLKELMPHAAAD
LWIQPPFYCDYGTNLHIGEKVFFNFNCVVLDVMQVNIGSRTLFGPNVQIYTATHPLNHQE
RASGLEFAKPISIGEDVWIGGSVVICPGVTIGDRAVIGAGSVVTRDIPPSVFAAGNPCRV
IRELP