Protein Info for CA264_09365 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4-hydroxybutyrate CoA-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF02550: AcetylCoA_hydro" amino acids 9 to 178 (170 residues), 95.9 bits, see alignment E=3.4e-31 PF13336: AcetylCoA_hyd_C" amino acids 270 to 422 (153 residues), 220.3 bits, see alignment E=1.2e-69

Best Hits

KEGG orthology group: None (inferred from 65% identity to cts:Ctha_0304)

MetaCyc: 45% identical to 4-hydroxybutyrate CoA-transferase subunit (Clostridium aminobutyricum)
2.8.3.M6 [EC: 2.8.3.M6]

Predicted SEED Role

"4-hydroxybutyrate coenzyme A transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS02 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CA264_09365 4-hydroxybutyrate CoA-transferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSENRVTYKTAEEALAVIKSGDRVFIQGSAATPQFLIRKLAERADELRNVELVSITTYGE
FPVAEERYKDSFFINSLFVSANVRDAVNSGRGDYTPIFLSEIPHLFRSGILPLDVAIVHV
SPPDRHGYCSLGVSVDVTREAVLSAKHVIAQVNPQMPRTHGDGLIHVKRFDVLVEVDEAL
PEVDYSLRITSKEEAIAKYIAEMVEDGATLQMGIGAIPDAVLGSLTNHKELGIHTEMMSN
GVMQLVEKGVITNEHKYRHPGRIATGFIVGNRKLYDFVDDNPLILMQRTDYVNDVTIIRS
NQKVTAINSAIEIDLTGQVVADTIGYHQFSGIGGQMDFIRGAALSPGGKPIIALPSVTNK
GISRITPLINEGAAVTTTRAHVHYVVTEYGVAYLYGKNLRQRAKALINIAHPDHRERLEQ
EAYKRYGYI