Protein Info for CA264_09360 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: phosphoglycerate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to PGK_CHLT3: Phosphoglycerate kinase (pgk) from Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 68% identity to sli:Slin_3127)MetaCyc: 53% identical to plastidic 3-phosphoglycerate kinase (Spinacia oleracea)
Phosphoglycerate kinase. [EC: 2.7.2.3]
Predicted SEED Role
"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)
MetaCyc Pathways
- superpathway of glucose and xylose degradation (16/17 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
- homolactic fermentation (11/12 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- gluconeogenesis I (11/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- Bifidobacterium shunt (12/15 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis IV (8/10 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- gluconeogenesis III (9/12 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- Entner-Doudoroff pathway I (6/9 steps found)
- sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
- glycerol degradation to butanol (11/16 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- ethene biosynthesis V (engineered) (17/25 steps found)
- heterolactic fermentation (11/18 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- oxygenic photosynthesis (10/17 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
- superpathway of N-acetylneuraminate degradation (11/22 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Glycolysis / Gluconeogenesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.2.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YRY7 at UniProt or InterPro
Protein Sequence (399 amino acids)
>CA264_09360 phosphoglycerate kinase (Pontibacter actiniarum KMM 6156, DSM 19842) MKTIHQYNFAGKKALVRVDFNVPLDENHHITDDTRIRAAVPTIQKILDDGGAVILMSHLG RPKTGPEEKYSLRHVVPRLEQEFHTNVRFAPDCVGPEAAQLAHELQPGEILLLENLRFHK AEEKGDPDFARELAALGDVYVNDAFGTAHREHASTAVIARYFPNDKMMGYVMQAELDNAS RVLDNAERPYTAIMGGAKISDKILIIEKLLDRVDNLLIGGGMSYTFVKADGGQIGSSLVE EDKIDLAKRLIAMAKEKGVRIMIPIDSVIADAFSNDANVDTALSHHIKPMWMGLDIGPEA REQYAEVILNSRTILWNGPMGVFEMSNFSVGTEAVAEAVVAATAKGAYSLIGGGDSAAAV NQLGYASRVSYVSTGGGALLEYMEGKTLPGVAAIERSDY