Protein Info for CA264_09325 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF02142: MGS" amino acids 17 to 108 (92 residues), 30.3 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 42% identical to MGSA_CARHZ: Methylglyoxal synthase (mgsA) from Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 42% identity to rmr:Rmar_2651)

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXY8 at UniProt or InterPro

Protein Sequence (121 amino acids)

>CA264_09325 methylglyoxal synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRTTIALIAHNSRKNDLLNWAKVHHEVLKDHELIGTTNTSKLLNDMLDLGVKGFGHGPSG
GDILLAAKILQGEVHKIIFFIDAETPHGHEHDIQTLIRTAVINNIPIALNRASADLIILE
E