Protein Info for CA264_09300 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 139 (137 residues), 38.6 bits, see alignment E=5.7e-14 amino acids 153 to 287 (135 residues), 41.7 bits, see alignment E=6.3e-15

Best Hits

KEGG orthology group: None (inferred from 46% identity to bwe:BcerKBAB4_3349)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YS04 at UniProt or InterPro

Protein Sequence (304 amino acids)

>CA264_09300 EamA family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MFRGIALVFLGACSFGVLSTFVKLAYKEGFNLGEVTGTQVFFGLIILWTLVLLRKLLGGK
SNSTSFKEKLKLVAMGTSTGLVSIFYYKCVQTVPASIAILLLMQFTWMSLLLDAIIKRKL
PSLTQVLMVVLVLLGTALAGRLFAGTVPDFDLTGIAFGLLAAVSYTFFLMINGSAGNNLH
PTTKSALILTGACVLVFSIFPPQFLVSGALFNGLFKWGLVLALFGTVIPPLFYAYGIPKT
GLGLSAILSAAELPVAVLMSSLILHEEVWAMQWIGVALILTAIALSNISSLGQKKKKRAA
AVAA