Protein Info for CA264_09295 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 61 to 247 (187 residues), 129.7 bits, see alignment E=6.2e-42 PF02592: Vut_1" amino acids 67 to 242 (176 residues), 158.8 bits, see alignment E=7e-51

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 70% identity to mtt:Ftrac_1525)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRV1 at UniProt or InterPro

Protein Sequence (268 amino acids)

>CA264_09295 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MVHTSPSQHAHEKKRTQLFLVLSGIFISNALLAELIGVKIFSGEALLGLPGAQIPTLGGA
KLDFNLTAGVVIWPVVFITTDIINEYFGKEGVKKVSILTVLLILYAFLVISAVTGLPPAQ
FWLDVNSTDPQGNPFDINYAYNSVYRQGLGIIVGSMAAFLLSQFLDATVFHWLRHITGSK
KIWLRATGSTLVSQLIDSLVVLFIAFYAFGNWSMEQVLSVAAINYIYKFCVAVLLTPLLY
VAHYLIDGYLGKRQAEELMEEAAVESGD