Protein Info for CA264_09290 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ribonuclease Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00753: Lactamase_B" amino acids 29 to 76 (48 residues), 22.6 bits, see alignment 9.5e-09 PF12706: Lactamase_B_2" amino acids 34 to 155 (122 residues), 36.5 bits, see alignment E=4.1e-13

Best Hits

Swiss-Prot: 53% identical to RNZ_CYTH3: Ribonuclease Z (rnz) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00784, ribonuclease Z [EC: 3.1.26.11] (inferred from 52% identity to mtt:Ftrac_1526)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRX6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>CA264_09290 ribonuclease Z (Pontibacter actiniarum KMM 6156, DSM 19842)
MDFELRILGSSSATPSANRHHTAQILTIGNQYHLIDCGEGTQMQLMLYKIKHQRICNIYI
SHLHGDHYFGLPGLLSTMHLQGRQTPLHLFGPPGLQEILSLQFKYSGTNLNFNLVFHELD
TSCHKKIFEDKSITVHTLPMEHRVPCAGFVFREKQKPRPLIKEKLPDFLRPPQLVRLKWG
ADILDEAGNVLVYNRDVTMEPKRSRSYAYCSDSRYKPELLPYLHNIDLLYHEATFTDELR
ERADYTFHSTARQAAALALAAEVRHLLIGHFSVRYKDLTPLLEEAREHFAKTDLATEGSI
FCVQE