Protein Info for CA264_09260 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: malate synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20656: MS_N
  • amino acids 7 to 68 (62 residues), 61.1 bits, E=8.6e-21
• TIGR01344: malate synthase A
  • amino acids 20 to 531 (512 residues), 803.9 bits, E=2.2e-246
• PF01274: MS_TIM-barrel
  • amino acids 159 to 402 (244 residues), 366.9 bits, E=5.5e-114
• PF20659: MS_C
  • amino acids 410 to 530 (121 residues), 121.4 bits, E=4.3e-39

Best Hits

Swiss-Prot: 62% identical to MASY_MYXXD: Malate synthase (mls) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 65% identity to sth:STH589)

MetaCyc: 50% identical to malate synthase (Arabidopsis thaliana col)
Malate synthase. [EC: 2.3.3.9]

Predicted SEED Role

"Malate synthase (EC 2.3.3.9)" in subsystem Photorespiration (oxidative C2 cycle) (EC 2.3.3.9)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• chitin deacetylation (2/4 steps found)
• superpathway of glycol metabolism and degradation (3/7 steps found)
• L-arabinose degradation IV (3/8 steps found)
• D-xylose degradation IV (2/7 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (3/14 steps found)
• superpathway of pentose and pentitol degradation (7/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.9

Sequence Analysis Tools

See A0A1X9YRX8 at UniProt or InterPro

Protein Sequence (532 amino acids)

>CA264_09260 malate synthase A (Pontibacter actiniarum KMM 6156, DSM 19842)
MIIESTVDVKGTMPTGFEEILTPEALEFLEMLHKKFDARRKELLALRVKKQEAIDAGKQL
DFLPETKEIREGDWKVGNVPEDLQLRRVEITGPVDRKMVINALNSGANVFMADFEDASSP
TWENLVQGQLNLRDAIHRDIDFTVQNGKTYRLKENVAVLKVRPRGWHLPEKHLTVGGDMI
AGSLFDFGLYFFHNAKELLQRGTGPYFYLPKLESHLEARLWNDVFVAAQEALGLPVGTIK
ATVLIETITAAFEMDEILYELRDHIVGLNAGRWDYIFSAIKRFRNREEVLFPDRTDVTMQ
VPFMQAYTTLLVQTCHKRGAHAMGGMAAFIPSRNNPAVNENAFKKVKADKAFEAEKGFDG
TWVAHPDLVAVAREEFDKVLGERPHQKEVRRENAEVTAADLTNFSIPGGKITETGLRLNI
NVGIMYIGSWLCGVGAAAIHNLMEDAATAEISRAQVWQWLHHPHTKTDDGVEVTEERVLH
LIKEETENIKEEVGLAMFKNYHYEKAAHLFSELVLTTCFVDFLTLPAYKYLD