Protein Info for CA264_09255 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: isocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01346: isocitrate lyase
  • amino acids 8 to 246 (239 residues), 357.6 bits, E=4.9e-111
• PF00463: ICL
  • amino acids 12 to 246 (235 residues), 219.8 bits, E=6.2e-69
  • amino acids 247 to 425 (179 residues), 183.5 bits, E=6.5e-58
• PF13714: PEP_mutase
  • amino acids 79 to 229 (151 residues), 51.2 bits, E=1.3e-17

Best Hits

Swiss-Prot: 71% identical to ACEA_BACHD: Isocitrate lyase (aceA) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K01637, isocitrate lyase [EC: 4.1.3.1] (inferred from 78% identity to fba:FIC_00669)

MetaCyc: 61% identical to isocitrate lyase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate lyase. [EC: 4.1.3.1]

Predicted SEED Role

"Isocitrate lyase (EC 4.1.3.1)" in subsystem Serine-glyoxylate cycle (EC 4.1.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.1

Sequence Analysis Tools

See A0A1X9YRX2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>CA264_09255 isocitrate lyase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKNERSQKIERDWIENPRWTGIRRPYSAEEVVKLQGSVQIEYTLARNGAEKLWRLLHSE
KYVAGLGALTGNQAVQEVEAGLNAIYLSGWQVAADANLAGQMYPDQSLYPADSVPNVVKK
INNSLLRADQIQSVNGEGEKDYMVPIVADAEAGFGGNLNAFELMKMMIESGAAGVHFEDQ
LSSAKKCGHLGGKVLVPTQEAINKLVAARLATDVMGVPTIVVARTDADAANLITSDIDPR
DHEFILDKPRTSEGFFHVRCGIEQGIARGLAYAPYADLIWMETSHPDLDQARQFAEAIHK
QFPGKLLAYNCSPSFNWASKLSVEEMETFREELAAMGYKFQFITLAGFHALNTSMFELAK
AYKERGMAGYSELQQREFGLAKDGFKAVKHQSFVGTGYFDAVQNTVTSGTTSTAALIGST
EEEQFQ