Protein Info for CA264_09250 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details PF01595: CNNM" amino acids 9 to 179 (171 residues), 80.1 bits, see alignment E=1.7e-26 PF00571: CBS" amino acids 264 to 315 (52 residues), 26.8 bits, see alignment 5.3e-10

Best Hits

KEGG orthology group: None (inferred from 50% identity to rmr:Rmar_0830)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRZ4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>CA264_09250 hemolysin (Pontibacter actiniarum KMM 6156, DSM 19842)
MGLLLLYLAVALFFSFLCSLLEASLLSITPSHVSIVNSENPSLGKDLQHFKDNIDRPLAA
ILTLNTFAHTIGAAGVGAEAQLLWGDEYLTAVSVVLTIIILIFTEIIPKTLGANYWKQLT
PFTVRTLKILIYSPLYPIIVLSQFITKRLKTEKGRSVLSRADFTAMAELGIKEGIFKKGE
SQIIQNILRFNNILVRHIMTPRTVIVSAQEDMTMADFFRDFPDLRFSRIPIYSENLDDVK
GYILKEEVLYKIIDGQGNQPLKSIRRKVQVVPEHMPIPTLFNKLLEQQEQIALVVDEYGG
TAGLISMEDMIETLLGMEIIDELDQVADLQTWARQNWEKRARRLGYSPE