Protein Info for CA264_09235 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 8 to 199 (192 residues), 175 bits, see alignment E=3.2e-55 PF08659: KR" amino acids 8 to 159 (152 residues), 60.2 bits, see alignment E=6.3e-20 PF02719: Polysacc_synt_2" amino acids 9 to 128 (120 residues), 26.5 bits, see alignment E=9e-10 PF01370: Epimerase" amino acids 9 to 163 (155 residues), 23.6 bits, see alignment E=8.2e-09 PF13561: adh_short_C2" amino acids 15 to 200 (186 residues), 114.4 bits, see alignment E=1.7e-36

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 49% identity to gfo:GFO_0966)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YRX0 at UniProt or InterPro

Protein Sequence (284 amino acids)

>CA264_09235 short-chain dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKIKNSTVLVTGGASGIGRLLGQRCLQSGASRLVIWDINCQNLQQVAQELQAQGHQVHT
YEVDVAKPEEVEQAAQQVMDTVGVPDILFNNAGIVVGKPFAEHSYFDIKRTLDINVLGVM
AVTRAFLPRMVARGSGHVVTIASAAGLIPNPRMSVYAASKWAVLGWSESLRLELEALKQD
LHVTTVTPSYIDTGMFAGVKAPLLAPILKPERITRAILEAVEQNKIILRKPAIVNLLPFL
RGVLPTKLFDKIVGRGFHVYSSMDHFAGRPAAEAVPREKEASKP