Protein Info for CA264_09225 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02754: CCG
  • amino acids 7 to 89 (83 residues), 60.3 bits, E=8.4e-21
  • amino acids 138 to 222 (85 residues), 71.7 bits, E=2.2e-24

Best Hits

Swiss-Prot: 43% identical to LUTA1_BACC0: Lactate utilization protein A 1 (lutA1) from Bacillus cereus (strain AH820)

KEGG orthology group: None (inferred from 67% identity to chu:CHU_1437)

MetaCyc: 39% identical to iron-sulfur oxidase subunit used in L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (2/4 steps found)
• pyruvate fermentation to acetate and lactate II (1/4 steps found)
• heterolactic fermentation (11/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See A0A1X9YRT5 at UniProt or InterPro

Protein Sequence (246 amino acids)

>CA264_09225 Fe-S oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MASRTIVDIFVPCFVDQLFPDTAMNMVKVLEKAGCEVRYNPNQTCCGQPAFNAGFFNEAR
EVADKFLDDFSSETSHYIVAPSASCVGMVRNAYQDIFVKSSKLVKYRAMQKKVYELTEFL
TDVMGITRIDGAALPGRYTYHDSCSALRECGIKAGPRELLSNVAGLELVEMEDSETCCGF
GGTFAVKFEAISTAMAEQKVDNAIATGADYIVSTDSSCLMHLEAYIQKQNKPIKTMHIAD
VLASGW